PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G15320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 194aa    MW: 22015.5 Da    PI: 9.3071
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G15320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.36.3e-16957149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     kri+n   +qv fsk r  ++KKA+EL +LC+aeva+++ ss g+l+ +
  LPERR11G15320.1  9 KRINNAEAQQVCFSKHRPSVFKKASELYTLCGAEVAMLVKSSGGNLFSF 57
                     79********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.362161IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-15323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-19365IPR002100Transcription factor, MADS-box
PfamPF003191.4E-171057IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MTKRKIEIKR INNAEAQQVC FSKHRPSVFK KASELYTLCG AEVAMLVKSS GGNLFSFGAP  60
SSCKTNCRIK MKKMKSLQEA FKQEADGNVM AWLDAKVEEI CKEDPEEFNR ILVSLKDMIR  120
GRTNQLFNNY AMYSNIMRLQ HCVTTLPNQQ VLNSEDVKPV IHHVPISSIG WNLGMDVNPN  180
SSVAHVDEIK RHFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642726.16e-84PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A0D9XTV31e-145A0A0D9XTV3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA022830-PA1e-83(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169561112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.12e-15MIKC_MADS family protein